PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_221550_mryh.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24138.8 Da    PI: 10.2052
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_221550_mryh.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.72.4e-261059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        +ien   rqvtfskRr+g+lKKA+ELS+LCdae+ +iifss+gkl+++s+
  Bv9_221550_mryh.t1 10 KIENIAARQVTFSKRRKGLLKKAQELSTLCDAEIGLIIFSSSGKLHDFST 59
                        79**********************************************96 PP

2K-box45.82.6e-16971692496
               K-box  24 LkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                         L+ke  +  +e+ +++GedLe Ls++eL +Le+++ek+  ++   K++ l++ i +l++ke  l e+nk+L+k
  Bv9_221550_mryh.t1  97 LRKEFGEKNQELSQMKGEDLEGLSFEELSKLEKKMEKGFGRVCRIKDDKLHKVITDLKRKESTLVENNKKLKK 169
                         5666666668899**********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.24161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002658.05E-35369No hitNo description
PRINTSPR004048.0E-26323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-28375IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.8587177IPR002487Transcription factor, K-box
PfamPF014862.1E-1395169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVRSKIQIQK IENIAARQVT FSKRRKGLLK KAQELSTLCD AEIGLIIFSS SGKLHDFSTS  60
SVTQVIQKYA RHHPTLSQQS DPSIFEPFLL EDNRAVLRKE FGEKNQELSQ MKGEDLEGLS  120
FEELSKLEKK MEKGFGRVCR IKDDKLHKVI TDLKRKESTL VENNKKLKKI TNATEGKVHN  180
VWKQQLSQFP DHNNCIQKNV SFDTALTLGL V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A8e-19388287Myocyte-specific enhancer factor 2A
3kov_B8e-19388287Myocyte-specific enhancer factor 2A
3kov_I8e-19388287Myocyte-specific enhancer factor 2A
3kov_J8e-19388287Myocyte-specific enhancer factor 2A
3p57_A8e-19388287Myocyte-specific enhancer factor 2A
3p57_B8e-19388287Myocyte-specific enhancer factor 2A
3p57_C8e-19388287Myocyte-specific enhancer factor 2A
3p57_D8e-19388287Myocyte-specific enhancer factor 2A
3p57_I8e-19388287Myocyte-specific enhancer factor 2A
3p57_J8e-19388287Myocyte-specific enhancer factor 2A
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153167KRKESTLVENNKKLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4545039e-92HQ454503.1 Beta vulgaris subsp. vulgaris cultivar US H20 MADS-box transcription factor AGL24 (SVP1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691403.11e-154PREDICTED: MADS-box protein JOINTLESS-like isoform X2
TrEMBLA0A0J8BIR51e-154A0A0J8BIR5_BETVU; Uncharacterized protein
STRINGPGSC0003DMT4000837396e-51(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-37MIKC_MADS family protein